DPCstruct | MC12286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P8EG16 | 81-171 | PKLAGGMNTLNREDPLKTVGSYWPHVSTVWDYVNRSMPFGAAQTLAPDDVYAIVAYILYSNDLIEDDFVLSNENLADFELPNVGGFF… |
| A0A537QFA9 | 42-129 | GGMGTLAPDKTPIKTVGSFWPYATTLFDYVRRAMPFQDSKSLTADEVYAVSAYILNLNGIVSSNDVLDAQSLPKVRMPNRDGFIPFPR |
| A0A7C5N7X0 | 1-81 | None |
| A0A1Y5FME0 | 50-145 | None |
| A0A231USV8 | 277-365 | None |
| A0A351V4C5 | 75-157 | None |
| A0A2V8I0N0 | 78-178 | None |
| A0A5C8KBQ4 | 101-183 | None |
| A0A5E7MKC8 | 2-94 | None |
| A0A538ABH3 | 132-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.