DPCstruct | MC12285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 146 ± 18 aa |
| Standard deviation of domain lengths | 18.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835DNJ0 | 164-315 | TVGDEKMKKRKGEEEKEIQEETGFLNFDEDLLFEVLKHVDARSLATAACVSKQWCRTVQDERLWEIICTRHWANIGCGDQRLRSVVL… |
| A0A2U1KA35 | 9-114 | ENMTTLNTDLFYDILRRLDGATLASASCACAAFSSMSKEEKIWENICSSMWPSTKNDDVKTLISSIGGFKKFYADCFPLIVNKSVPD… |
| A0A2I0LG33 | 1-139 | None |
| A0A151RPG5 | 1-147 | None |
| A0A7C8Z7B9 | 74-219 | None |
| A0A5A7PLQ1 | 3-126 | None |
| A0A1D6Q3S6 | 79-219 | None |
| A9LY11 | 1-153 | None |
| A0A835IN13 | 9-159 | None |
| A0A835RBP7 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.