DPCstruct | MC12284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 88 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.65 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | CL0123- CL0573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835DKX3 | 1-84 | MGSWSAKQNKSFERALAIFDKDTPERWHNVASMVGGGKSTEEVKRHYDDLVEDLKCIESGQVPFPNYKPIAPSSKPKPPPPSHL |
| A0A2J6L5E5 | 4-88 | VNWSWDENKIFENALTLYPEDAENRWELIAELLPGKTAQDVKAQYQKLIQDLEAIEAGLVPLPAYREFSEEEMAEARKKLAEEQE |
| K4AHE5 | 2-80 | None |
| A0A6A6LJQ0 | 1-83 | None |
| A0A166CBD6 | 114-203 | None |
| A0A5N6Q932 | 524-625 | None |
| A0A1U7Y6T4 | 1-93 | None |
| A0A445J157 | 369-434 | None |
| A0A834SIF0 | 2-95 | None |
| A0A6P6GDD2 | 2-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.