DPCstruct | MC12283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812GJ60 | 114-231 | DAKFLWQALKGEKLTLSGDTESAKELLENLGAEIDSAYEVQALIQSHFHKTNALLWKTLGRSQEFYKSSILYLAFTPLEAIPVEERP… |
| A0A835DJI2 | 1-99 | MQIAVFKLEKGDQHECKKLLEDGKTSLDSMTDIDPSVYASYQWFSSQYHKSRQEFAEFYKSALLYLAYMSVESLSDTFKLDLAFDLS… |
| A0A251T3X3 | 79-191 | None |
| A0A0N1P2Q7 | 115-233 | None |
| A0A182VZF7 | 643-773 | None |
| A0A662X4J4 | 611-735 | None |
| A0A2H6KF77 | 114-223 | None |
| A0A654HK05 | 28-159 | None |
| A0A1Y3BLG8 | 452-584 | None |
| A0A7R8CI19 | 312-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.