DPCstruct | MC12280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 224 ± 27 aa |
| Standard deviation of domain lengths | 26.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 61.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3XCZ6 | 3-185 | DSIIKVYGALRVSVKMLLMLQSEIQVDGGGSTVVTTSVLEVRNLVVLKGKSVISSNANLALYGQGLLRLTGDGDAIIGQRLSLSLFY… |
| A0A835D457 | 15-278 | LANLIWRYNSVYGAFRMAVKMLLMWNSEIQIDGGGNTIVTSSVLEVRNLVVLREKSVIGSNANLGVCGQGLLKLTGHGDAIKAQRLS… |
| A0A446IQS4 | 147-327 | None |
| A0A453E6Z2 | 48-291 | None |
| A0A453E6Z4 | 357-600 | None |
| A0A438DSL8 | 1-245 | None |
| A0A3L6PUQ6 | 3-170 | None |
| A0A6P6SHP1 | 103-318 | None |
| A0A2I0X436 | 377-624 | None |
| A0A453A9X6 | 143-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.