DPCstruct | MC12279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 81 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 57.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02701 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9T7A1 | 1-51 | IPCPRCQSMNTKFCYYNNYSVNQPRHFCRNCQRYWTVGGTLRNVPVGGGSR |
| A0A835D004 | 1-79 | MTDIRPTRSGGGRIFGGDRRLRPHSNQALKCPRCESLNTKFCYYNNYNLSQACHFCKNCRRYWTKGGVLRNVPVGGGCR |
| A0A4Y1R9T7 | 1-77 | None |
| A0A1D6GE51 | 282-370 | None |
| A0A1D6GM25 | 6-115 | None |
| A0A1E5V3D8 | 57-133 | None |
| A0A0E0JNX0 | 205-306 | None |
| A0A4S8IB44 | 106-195 | None |
| A0A4Y1R7X5 | 130-209 | None |
| A0A6A2YN12 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.