DPCstruct | MC12278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 173 ± 43 aa |
| Standard deviation of domain lengths | 42.87 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19553 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6VFT2 | 6-138 | QYSCEYISEVCLVTILELQESHYIIKKCGNCGKYFIPYNRADTIYCDNISPQDDKRTCKEYGSQKLWYDKLKQDEAKKLYRNIYMAK… |
| A0A3D1RIN1 | 61-192 | EIKELYEIKDMNDLIRFELLKFVSSDIEFKECENCHQYFIPVNRKDEIYCNRPIKGTEKTCKDVGAMNRHKEKAGDIPGEKEYWRVY… |
| A0A1G4WXE2 | 61-228 | None |
| A0A412L754 | 18-181 | None |
| A0A645C174 | 58-256 | None |
| A0A1Y4IWY6 | 271-474 | None |
| A0A1V5XA93 | 64-238 | None |
| A0A1V5XGY5 | 84-305 | None |
| A0A1Y4LI95 | 176-334 | None |
| A0A1C0BHX4 | 9-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.