DPCstruct | MC12277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1IWJ7 | 22-186 | DEQPSDRMLAILSMLYLLVMVGVFLWGMFDVWVGRYTVVRWLGYGSEVEMQRLEEPIFRLLAYAFLGGGVGGAVNGIRSLLTWHVEW… |
| A0A2W1AU92 | 110-277 | DPDPWSAPILAMYLLAFGIAGLLAAVSQWSDVRALTDNDPETVAALRPNILLGLDWQVGGEELLLIFVASIGVFFGCLAGLRTAATY… |
| A0A3M2FNB7 | 103-259 | None |
| A0A164AQH0 | 10-152 | None |
| K9RWF3 | 69-236 | None |
| A0A0M2USI0 | 24-201 | None |
| A0A1I6L1V6 | 13-142 | None |
| A0A524K0W1 | 55-217 | None |
| A0A3C0MYZ3 | 2-157 | None |
| A0A3C0BTN5 | 70-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.