DPCstruct | MC12275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 11.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366F489 | 22-107 | ALAESERSGQGGVIHFRGQIVEGGCAVKPSTDNVNVSCYRDGNHHQSTIPVTSLSHGETQHLRDATLDMKWLNKQKTLAVISVQYQ |
| A0A4R6E2K0 | 18-103 | CVPLLNAHASDGVIHFRGSIVEAPCTFSQREQSVKLSCTQDGKPVVRTVAFNQLYNYKPDNNVPLTTQIHYLDPQRKLAVLEVTYR |
| A0A0L0AR98 | 11-93 | None |
| A0A133LCG8 | 2-83 | None |
| A0A837K7U4 | 8-87 | None |
| A0A380PTG7 | 60-143 | None |
| A0A356D526 | 26-117 | None |
| A0A376JID0 | 1-74 | None |
| A0A3B0MGS8 | 3-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.