DPCstruct | MC12274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 178 ± 26 aa |
| Standard deviation of domain lengths | 26.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V4HWG4 | 5-186 | ESVLQDCQMYIDFLQKCDRGYFLTRGVLDKNVEIVRKEYSVAQRKPKTIGQELHDSLNMHFNEIFGWPVRNGLFCYGIRIDLEKEIK… |
| A0A223PAQ1 | 7-156 | HDDWKPLSGGMLLYRGFSQKAPEDTVLVRSPTDRKPAHMPLSVQHQMDDWFEKELGTRFRQRSLFTTGSLDVARRYAGDHGEVRVIQ… |
| A0A1G0EHV7 | 9-172 | None |
| W7TTV6 | 131-310 | None |
| A0A5J4Z442 | 75-265 | None |
| A0A0G4HTI5 | 153-346 | None |
| A0A4Q3P1X4 | 16-154 | None |
| A0A6M3IRT7 | 22-183 | None |
| A0A1Z5JZE2 | 78-227 | None |
| A0A094KYD3 | 20-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.