DPCstruct | MC12272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.90 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4S721 | 1-129 | MDDIQKDNINTPEESADLAKEISLAEDKKAAAQTLVDALLSEHAKQTLQTELDELTPIGSPQVNDENHNGVPDKEDSLFDETTKAYE… |
| A0A380IYL8 | 270-399 | AGKDKKAEVEADGVVNPDEKSAVDGLNDVTTEKKGTATPLVDSLPEGPVKEALKARLDQVTTSEVTVNDADSNGKPDSQDAAEAAAE… |
| A0A263HHL7 | 1-111 | None |
| A0A376Y5J2 | 42-171 | None |
| A0A376Y371 | 61-190 | None |
| A0A376Y320 | 434-563 | None |
| A0A376ZSY6 | 287-419 | None |
| I2SNP8 | 116-251 | None |
| A0A7U2VUR7 | 35-168 | None |
| A0A240BSQ1 | 56-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.