DPCstruct | MC12271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174C999 | 1-75 | MYIHEAVEKAVKENGKIIRSSARRPESDIYSEITPTNSYDACLITVLHDGKPRKTAGRWNPTADDLMADDWTVIT |
| A0A291JMK5 | 1-71 | MNIQEATKLAMEKGKPIYREAWEADDFSVAVRLLPTNEFGYITVSNQNKDFIPLWQPMAEDLLANDWSIYS |
| A0A3E2ND16 | 1-62 | None |
| A0A5M9RE92 | 9-79 | None |
| A0A2A4GUM3 | 1-71 | None |
| A0A3D3W9H5 | 1-70 | None |
| A0A3D5P7N7 | 1-57 | None |
| A0A3E3K191 | 1-76 | None |
| A0A512QGF2 | 1-72 | None |
| A0A1C6K9I5 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.