DPCstruct | MC1227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 3.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379TUN1 | 11-80 | GVTVLRLENGDEAVYIHGLFLECADIAQGDKPLTDIAARLAGLLKIPFRQITLPVPDDEEWCWNDIVDAL |
| A0A2D0L9F7 | 2-79 | NLPKIIFVSMTCGDEILFVNGKQIYMSSTSGSALGAYELATRLAKSLEIQLVEYNNIPEPEHDDWNAADVLTSLTELS |
| A0A246NG25 | 22-94 | None |
| A0A193KJ31 | 1-75 | None |
| A0A2V2BD46 | 12-81 | None |
| A0A760D3P4 | 1-76 | None |
| A0A1W6KFG4 | 54-124 | None |
| A0A217EVX5 | 1-73 | None |
| A0A7Y6TTE7 | 19-90 | None |
| A0A2W0FYR3 | 12-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.