DPCstruct | MC12268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 69.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4E8K5 | 247-326 | EGHNVIFLSNHQTEADPAVMALLLEHSHPYLAENLTYVAGDRVVLDPFCKPFSMGRNLLCVYSKKHIHDVPDLAEMKIKA |
| G3EXM8 | 211-290 | KGHNIVLMSNHQTEADPAIIALLLEATNPHIAESMTYIAGDRVLIDPLCKPFSKGRNLLCVYSKKHMYDDPELVEMKKKA |
| A0A6A6M644 | 154-233 | None |
| D7FWA5 | 63-143 | None |
| A0A438GC51 | 15-96 | None |
| A0A7J0FAB2 | 1-81 | None |
| A0A811MW68 | 207-286 | None |
| A0A2R6X008 | 250-320 | None |
| A0A7J8WVQ5 | 19-98 | None |
| A0A835Q2W9 | 994-1064 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.