DPCstruct | MC12265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 262 ± 37 aa |
| Standard deviation of domain lengths | 36.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0672- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8RXM8 | 8-231 | CAAIARVQPFTLTLSSYYFAPNIRNLAIAAGWNASAPLIVSITATTGGAINVPSAASASFPGGLTLQIAAGARVLGAQVGPGSSRGG… |
| A0A2D7YQZ4 | 93-373 | EVAHLYLLDNSTQAGTWHIVEVGTASISSAQTIQIDEFTIEFGPGMNLDANIRTMCDDLGYAGTNPARVNVFVGPQGAATVGAVGSS… |
| A0A7T9DMF6 | 590-868 | None |
| A0A4Q5VN00 | 268-579 | None |
| A0A521TFG0 | 517-792 | None |
| A0A0S6USN2 | 488-779 | None |
| A0A7U0PP11 | 51-292 | None |
| A0A6N8BWZ0 | 193-436 | None |
| M9RNP9 | 55-255 | None |
| A0A6M1SQ73 | 323-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.