DPCstruct | MC12264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 249 ± 28 aa |
| Standard deviation of domain lengths | 28.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0ALI8 | 1-274 | MTVTCANTTSQQVSIFEMNEPINQGLNDDSMMGKRPVKESTFVEIVNSVLRCDGQAFSIRETAPTRLEITNSALMISQSLIELVGCN… |
| M5TVF7 | 1-176 | MIETGGSMQLPQPKSGSIRLSLQRLTAYVPRGLLSMRLGVGGIHPVAIERQAEESVFVVGRGVPHVEITGISREDELQSWLRLRGAS… |
| D2R8I0 | 820-1061 | None |
| A0A2S8F5J2 | 647-901 | None |
| A0A4V0HVH5 | 1018-1275 | None |
| A0A1N6GZT5 | 1-242 | None |
| A0A3M1R8X0 | 89-342 | None |
| A0A3D3R3V6 | 281-553 | None |
| A0A7X7KGY0 | 431-665 | None |
| A0A2H6AAW5 | 373-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.