DPCstruct | MC12261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1AI50 | 182-266 | LGADYYETDAEIASQLAEGKVPLGIGENTRIKDCIIDKNARIGKNVVIANSEGVQEADRSSEGFYIRSGITVISKNSTIPDGTVI |
| A0A3B8ZN28 | 3-83 | SDLTDSPADLAQHAAAGRPPLGIGSGSRIIGAILDKNTQVGQNVIIENVKQVENSDAQPPCLIRDGIPILCKEGILRDGFR |
| A0A1V6EKJ4 | 12-89 | None |
| A0A7S3E1S5 | 80-164 | None |
| A0A0P0XF97 | 25-109 | None |
| A0A7J7N1G1 | 44-128 | None |
| A0A7J7MXV5 | 90-174 | None |
| A0A2J7ZPG5 | 1-63 | None |
| A0A5N6QHW2 | 885-968 | None |
| A0A7J7L748 | 184-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.