DPCstruct | MC12260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 34.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498C853 | 1-125 | MKSSVESQSSGLDKAKIIVAIALVFGAIAGFHYYGDEPLLFRVLGLLAVVAAAGGVMMTTAAGQAVWQFARTSRQELRKVVWPNRQE… |
| A0A5C9AWG3 | 2-112 | ADNIKLIAAGLLIAAGIAGFYVLSEMPTVVRVLSVLGGLAAAVGVAWFTEPGRRFFAFSQESVNEARKVVWPTRKETMQMTGVVILF… |
| A0A525CEB0 | 1-147 | None |
| A0A7U8C1D3 | 52-173 | None |
| A0A841N167 | 2-113 | None |
| A0A1X0TJM0 | 31-150 | None |
| A0A450SM65 | 109-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.