DPCstruct | MC1226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U4I816 | 14-87 | ELPTLERVYALLKDNYKPARFADRDGEIWGHEYSWNLAKSSLQDLEKYGKSYVSKHSDRMGDGFSFGPDLVIIR |
| A0A2D0L9B2 | 3-73 | TPEQHYEFLKKHYREQHFEGRNIQGWGENYSRIIAEYRYKDLQKYGFDIIEYHKSATNKAICYDINLNLIT |
| A0A899NFZ0 | 7-79 | None |
| A0A2S1PJZ4 | 3-74 | None |
| A0A0K0MPP1 | 44-125 | None |
| E6XS69 | 2-100 | None |
| A0A411H8C9 | 2-83 | None |
| A0A706RJ51 | 2-63 | None |
| A0A5X0KJ68 | 45-118 | None |
| F6CGJ5 | 3-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.