DPCstruct | MC12259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 177 ± 43 aa |
| Standard deviation of domain lengths | 42.55 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8ZE80 | 6-186 | TDILLATEGTYPFAVGGVSVWADQLVRGLPERRFTLYAVVANPYAVLRYRLPPNVEAVWTVPLWGTESHAEYGRHPGWWARPRRGGD… |
| U4TLT6 | 2-171 | KIAMIAEGCYPYVTGGVASWIHQLMAAIPAHDFTVLAVTADDTPPASRFPPLANLSAVVNFSLTCRSVQKRPVRLQAADRDLISQWL… |
| B1V7R1 | 1-149 | None |
| A0A662PWN2 | 7-187 | None |
| F1VVI8 | 11-183 | None |
| A0A358SMN4 | 26-144 | None |
| A0A177LAS8 | 1-158 | None |
| A0A174A931 | 3-139 | None |
| A0A022MQ85 | 1-114 | None |
| A0A657IV82 | 2-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.