DPCstruct | MC12258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 59.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5A3W4 | 1-58 | MISPSLEIIEQCKTAISEWLKPVGLEIKPEKTRICHTLNPIEYNGKTEEPGFDFLGFN |
| A0A5F1B6R7 | 1-67 | MSVIFYCDDFVIIHENEEIILKAKILVEEWLETIGLKLKPSKTRVSHTLRTIDETKPGFDFLGFSIR |
| B5W8P8 | 1-75 | None |
| B5W4G5 | 9-82 | None |
| D4ZPV2 | 67-140 | None |
| G5IYK8 | 4-64 | None |
| A0A6P0PFD1 | 25-86 | None |
| A0A7Z2HEF0 | 59-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.