DPCstruct | MC12256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 173 ± 36 aa |
| Standard deviation of domain lengths | 35.92 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3XE35 | 290-477 | NLTTTMNKPEILTLSSVVNLFDLKGLYLIGYSWLFGMSLWVTFFGGVIAYRALPRQQFGALQHRTFPVYFVISMLLSSTLTGLWTYS… |
| A0A3N0V676 | 2-117 | MVAVLSVMVFFSLIIAPMLFSTLSATYAGAFVRKFFPRYYLILGLVSLLTGLIATDATVAGIGFACAVLFLLSLFLTPAINRASDRH… |
| E7G3Q5 | 1-182 | None |
| A0A1E5UZF8 | 763-957 | None |
| A0A3M7LWG3 | 11-189 | None |
| A0A6L8QAY6 | 1-146 | None |
| A0A523JNP0 | 53-205 | None |
| A0A0G4M5X0 | 111-265 | None |
| A0A1S3J639 | 2-157 | None |
| D8LRR6 | 55-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.