DPCstruct | MC12255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 357 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 66.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6P0M9 | 33-418 | EFSPPLDTSLIAAIVADYMIDNKTPSVDELSSLRRILAELASQAEQDEDTLSYQLSNAIQFSTTEDTTSINATDIFSVYADGSESVA… |
| A0A4S4LJ40 | 1-340 | MNGASHANASPQETLEAEFCPPLDTTLVAAFLADHLTDSGELTGDALQTLRDHLSLLAASAAADQDDLASDLADHQQIAQSTTTDDS… |
| A0A4S4M5Z6 | 29-387 | None |
| A0A7R7X7A1 | 1-354 | None |
| A0A1C7NL03 | 36-356 | None |
| A0A6G1NVP7 | 2-357 | None |
| A0A0A2KC96 | 1-366 | None |
| A0A1S9RFK3 | 386-743 | None |
| A0A163J5P2 | 15-384 | None |
| A0A0B7JIC5 | 2-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.