DPCstruct | MC12253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 13.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 85.64 |
| Assigned Pfam label(s) | CL0023- CL0346- PF00238- CL0020- PF16205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q38DP8 | 82-184 | SLIFNQPRQGSDKIGYVVGTSMLKTAVVATNHMVYYPKFNQRVSRTKRFFAHDEDLVCVEGDLVHIKQCRKISKYKHYYVFSILEPN… |
| A0A4S4KZD8 | 4-91 | LILQGIVTKVGYMNKTATVTVSRWAVHPRTQKRFERSKKYLTHDPENTLRQDDVVTIQNCPPVSARKRFTLYKVLKSSGGDRIQRHLR |
| A0A0D3A9C6 | 157-252 | None |
| M1VBT5 | 122-211 | None |
| A0A2H2Z5J5 | 1-83 | None |
| G4LZ88 | 44-163 | None |
| A0A3P6CCP5 | 1-71 | None |
| A0A3P8NP01 | 68-170 | None |
| A0A662MH33 | 50-128 | None |
| A0A1E5VCG1 | 32-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.