DPCstruct | MC12252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H9H4E3 | 1-108 | MIESYQAASLETAACIWEHVLDVLHNGAGSKGLRGQAERIREEMGTSALRITAIGWTALADADWGLVKDDYDQPFDWAFIPAWVRAN… |
| A0A2K0YC54 | 1-123 | MNQSEEFSLETAACLWEAVLALRDQTSGDQAAKLLAAAIARSFETVGTAALRLIVVGWTSAVEKAWQEVSATYPLCFDWDFVPGWVI… |
| A0A7Y0I2R8 | 1-108 | None |
| A0A013WY56 | 1-124 | None |
| A0A494W079 | 1-98 | None |
| A0A4P6FVV3 | 89-201 | None |
| A0A1G5T2H1 | 41-152 | None |
| T0I306 | 43-166 | None |
| A0A1B3MQ26 | 1-111 | None |
| A0A1B3ZDR7 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.