DPCstruct | MC12251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06949 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6EHM8 | 2-86 | DTVTLLLDNDESVECAILCILPVQGKDYIALLPLDDEGDTDEESRVFLYRYLETEGEEPQLENIDDDEEFEIVADAYDEWLDAQE |
| A0A117J4D7 | 1-73 | MTLEYDDGTSEKCDVLGIFPYDGREYIALAPEGDQKSLYLYGYVEHDDGTNDIVPIEDDTEFDAVAAEYQSLM |
| E0NLB4 | 21-112 | None |
| A0A7C6CJ58 | 1-97 | None |
| A0A4R2L1L2 | 2-81 | None |
| V7I0G6 | 10-100 | None |
| A0A5R9GEN0 | 19-100 | None |
| A0A0Q4QR00 | 63-143 | None |
| A0A7C6BNQ1 | 11-99 | None |
| A0A4P6UW77 | 11-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.