DPCstruct | MC1225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5SLH4 | 66-162 | ELVVIQPLNKEWKCHRCGQQKGDLLIMETPGPSCLPCAGLDDLMFLASGDALLTRRAKAKSARYAVVVRFSRTRRRYERQGLLVELK… |
| A0A7J9XTJ8 | 137-228 | ELVVISPLKEWTCATCGGSGDLLFMREEGPVCMACAALDHLVFLPRGDAGLTRRAHKASELSAVVVRFSRTRKRYERQGLLVEPDAL… |
| A0A517P0C7 | 81-182 | None |
| A0A2V7TNE9 | 3-116 | None |
| X1NFH9 | 11-107 | None |
| A0A2V7X9P0 | 89-204 | None |
| A0A7V3T3A5 | 10-117 | None |
| Q01Y87 | 32-133 | None |
| A0A098B7R0 | 1-106 | None |
| A0A3D5DTS3 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.