DPCstruct | MC12246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.08 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF00521- PF16898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JH90 | 72-144 | ELVLFSNMDNERSIPSAVDGLKPGQRKVMYTCLKRNDKREIKVAQLAGSVAEHSAYHHGEQSLMSTIINLAQN |
| A0A817KRL1 | 131-199 | NKELVLFSKPSTERAIPSIMDVLKPDQRKIMFVCFTKSLICEIKVAQLAGKVAENSDYHHDEQSLTNTI |
| T1GDZ7 | 367-439 | None |
| A0A817CBT0 | 375-438 | None |
| A0A820W2Q7 | 73-155 | None |
| A0A820PZH8 | 83-149 | None |
| A0A1D6HGY6 | 414-482 | None |
| A0A833ZS66 | 624-695 | None |
| A0A2G9UGT2 | 60-144 | None |
| A0A2P6SP06 | 227-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.