DPCstruct | MC12245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4HKV7 | 80-206 | GGTIGSLFFLLPAFFFEFAAFRPERDAELILLLNDIGWLLLITPAPPFLLQALSLGAAILTDKNATPIFPRWAGYFTLWVAVLLIPA… |
| A0A2J5HTD2 | 23-159 | LQSSCGTAAGMSLAVIAPCFGATVYRLERDPALTQLLNDLSWLVFTVVTSQFATQEFAISFGILSDTRAKPLVPHWVAWVNSLLTLT… |
| A0A0Q8VAH2 | 4-143 | None |
| A0A2T5M6J8 | 102-254 | None |
| A0A7I8A192 | 2-134 | None |
| A0A1V3X6X8 | 3-108 | None |
| A0A7I7UQR2 | 81-222 | None |
| A0A7I7UFH6 | 183-327 | None |
| A0A841P1Y7 | 85-214 | None |
| A0A841NKM2 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.