DPCstruct | MC12244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0CHW6 | 2-59 | ACIPSDCACIGGQGQFCGNDAINPACTNGHVFECNAQTGKTCNYGVRDSCVQCGQLQC |
| A0A2J5HS05 | 13-70 | ACKPSNCVCIGRQGQFCGDESINKACTNGHVFECNGNSGKSCDYGLRDSCRKCGKLDC |
| J0DAR0 | 49-113 | None |
| G4TNM6 | 18-96 | None |
| J5RHB3 | 120-188 | None |
| A0A2I1DRR5 | 18-87 | None |
| A0A1X2IAR0 | 25-80 | None |
| V2YT60 | 57-119 | None |
| A0A427XSF1 | 52-118 | None |
| A0A4Y7PXF0 | 55-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.