DPCstruct | MC12242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 127 ± 29 aa |
| Standard deviation of domain lengths | 28.52 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SMS6 | 17-108 | AAGNFGTCTDPSIKFAAGLDGRKESAFIPNNLKDFGHGSAQKVGIIAGFICQRLSDSCKAPAAIQGTCAQASAAAVAATQNQAAADA… |
| A0A2J5HEZ1 | 100-203 | TETVTSCPTSPPRFDYGNCSDPSISYEYGLEGSTEWQFITNNQKDFEHHPTDSIDTLMSHVCNRLRSPCNAPQSTVARCEASSQQVN… |
| S3BUJ8 | 144-235 | None |
| A0A3N4KQ25 | 275-353 | None |
| A0A438NE58 | 19-125 | None |
| S3CZE9 | 629-719 | None |
| E5A4Q0 | 340-480 | None |
| A0A0B1NVJ8 | 254-350 | None |
| A0A0G2FM18 | 168-260 | None |
| A0A319EGC1 | 119-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.