DPCstruct | MC12239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 149 ± 19 aa |
| Standard deviation of domain lengths | 19.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3ZD72 | 38-195 | RRRVCITVNAKKRSKPVLKPSVVEKVSLVDEAEDELLLEDEDLVDDDDGVFDEYFEEDAELYAGDGSGGGGISLAGTSWDKRALELA… |
| M5VV18 | 1-148 | RNSEPEPLLKPTIIKEVSEDDEDDDNVILDDFKEDEVSMNDEGDDYYEEDSVELYAGDGGGGGGISLAGVWWDNKALEIAEEVILSF… |
| A0A0B2SHF4 | 54-169 | None |
| A9SQM5 | 326-486 | None |
| A0A2I0AG74 | 61-202 | None |
| A0A287II72 | 36-184 | None |
| A0A6D2HEY9 | 631-806 | None |
| A0A2P2KSG5 | 96-217 | None |
| A0A6A2WXD2 | 58-229 | None |
| D8TJS4 | 176-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.