DPCstruct | MC12238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 198 |
|---|---|
| Mean domain length (aa) | 196 ± 43 aa |
| Standard deviation of domain lengths | 42.86 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.21 |
| Pfam Score | 87.22 |
| Assigned Pfam label(s) | CL0323- PF04560- PF04997- PF04998- CL0410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5VIF3 | 1-97 | MHARSIGPYSLITQQPLGGKAQFGGQRFGEMEVWAIEAFGAAHVLQEILTIKSDDVVGRSKAYEAIVKGEPMPTPGIPESLNVLLHE… |
| M5VU06 | 196-404 | SQLWPDIDMPFSEVTGMRPDLNINPHAFPSRMAIGMLLESIAAKVLYSGVYGTELTCEIFIGPVYYQRLQHMVSDKFKIFSVHSTGM… |
| A0A7S1UKE4 | 32-256 | None |
| A0A7I4DFK5 | 130-304 | None |
| A0A7S0MES3 | 531-747 | None |
| A0A6J5VR40 | 1-177 | None |
| A0A0G0D8M1 | 4-126 | None |
| A0A0N5CT39 | 12-151 | None |
| A0A421JS00 | 36-190 | None |
| A0A438DLS7 | 331-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.