DPCstruct | MC12237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 68 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085LYD8 | 689-751 | EEVIVFIFGGATYEESLAVYNFSQNFPLKVLLGGTAMHNGRSFIEEVINATQGASATGAARHH |
| A0A446L0F9 | 193-253 | FQQGRPQDVVIFIVGGTTYEEARSVALYNAANPGVRFFLGGSVVLNSKRFLENLGEAQRIS |
| A0A448X8W9 | 137-214 | None |
| A0A7S0HZT7 | 125-196 | None |
| A0A7S1H2X9 | 52-136 | None |
| H9JTD6 | 175-241 | None |
| A0A5B7DAJ0 | 32-85 | None |
| A0A7J0GGH9 | 123-176 | None |
| A0A834Y1L6 | 1-71 | None |
| A0A316VVU6 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.