DPCstruct | MC12235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 141 ± 23 aa |
| Standard deviation of domain lengths | 22.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.38 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF01874- PF03802- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5B934 | 124-275 | QAERIGRTAQRAMLYELAATPKPGLVDRRNNGAHTDMDFYTFIDSACITAPYFAQCAREGLNGPADGAALFARLKMHGLKAEGDMLA… |
| A4MZ37 | 182-297 | AEHIGEQVYLALIQEARLSPKPGLVDAINNGSHKDMNLHTFEQSAISLKPFFTQFVLKGMMTEHLSENQILAEIRPLGLLAEKAMFK… |
| A0A5E5R4I7 | 15-150 | None |
| A0A4U9HTF1 | 3-143 | None |
| A0A4V1XRB1 | 461-606 | None |
| A0A7C6WHQ4 | 71-220 | None |
| A0A7X9P4J9 | 1-224 | None |
| A0A0B8NY93 | 1-136 | None |
| A0A7X7J9Y5 | 243-385 | None |
| A0A2X2SZY7 | 13-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.