DPCstruct | MC12232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 164 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537ZYE9 | 83-244 | DEYAPAAKFLGTHRVNRNPAHVTYVVNPTMDFPKAGTVADHAYWLSGLRLRNSGGEAPLGSVDAKSDGFGKGDPRASATRHTVGTLN… |
| A0A417XTJ3 | 758-919 | RRPLADFLHRARSPHSPDRVTYVVRDRAADRRWGLEADTAYWLTDARLRDMSSSGEGFVDAVTFAAGGRATTPVGPSVTTGVLQPAS… |
| A0A538LIT1 | 419-596 | None |
| A0A2R6L8A5 | 83-245 | None |
| A0A6N7G4D5 | 256-415 | None |
| A0A538IGR7 | 119-276 | None |
| A0A554NBK4 | 634-811 | None |
| A0A538ILY0 | 43-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.