DPCstruct | MC12231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535UN69 | 1-88 | MARMVKCVKLGRELPGLDKPPFPGELGKRIYENISKQAYDMWPAQSTLIINHYGLNMADPEARKLLREQMEEFFFGQEAKMPEGWIPE |
| A0A2E1JZE9 | 1-75 | MTTLHCHYLKEQGTQLSSPPYPGIVGDVIHHTICQAAWSAWLAYQTQLINENRLNPLEKADRLTLEKAMIDFFDL |
| A0A3D2AYZ7 | 2-70 | None |
| A0A3M2D8G3 | 33-117 | None |
| A0A7C3TN01 | 75-151 | None |
| A0A521UTW0 | 46-127 | None |
| A0A3L7WUM9 | 82-167 | None |
| A0A3M1DUC2 | 34-107 | None |
| A0A651HPY6 | 49-127 | None |
| A0A6N7EU89 | 53-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.