DPCstruct | MC12228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 204 ± 34 aa |
| Standard deviation of domain lengths | 34.14 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A563EST7 | 3-196 | YQVTRVALHGVAELVLAGPQYDAIGTIKLRVTPGGFGTIGAPGLRVDGDQLITPGGTLPLTGTYEELAAAAGVAARPLRDVYHDGPD… |
| A0A3M1II59 | 29-246 | MPDESHKAMLFQEEELCFETKDSPHGKVKYYPVTHKITLEKSTQEREIFLGGKTWNEVIKEMQTFFSEESLQWPQYPEFPEYKIQHG… |
| A0A535VTI1 | 8-200 | None |
| A0A561UUF3 | 48-287 | None |
| B8IFC3 | 20-244 | None |
| A0A6G3VGC2 | 2-180 | None |
| A0A3N1L405 | 32-286 | None |
| A0A3M1Z702 | 3-114 | None |
| A0A2E2P1V4 | 6-219 | None |
| A0A6C1NMG9 | 23-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.