DPCstruct | MC12227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 174 ± 24 aa |
| Standard deviation of domain lengths | 23.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.11 |
| Pfam Score | 75.24 |
| Assigned Pfam label(s) | PF10679- PF13785 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800J848 | 6-163 | GPDQPIRPGDEAVFEGENHLVMGWMRYEGWDDEDRWRWDEWQLVSDSGTPRYLSWSGDEGWTLQTPIRPTPKVTRTGIKLEKGRATI… |
| A0A3M1IHZ6 | 47-203 | SGVVEDGSPIQLGTVGKWNNIPFEVIGRIQLHYALGFWNEWHLDLNGESAWLSESNGNYVISKKVEALVPKAEELKVYSYVDIAGKA… |
| A0A1Z2KZX9 | 19-192 | None |
| A0A356KTF2 | 191-350 | None |
| A0A066ZC93 | 2-154 | None |
| A0A661P1Q4 | 29-179 | None |
| A0A1I1VQD1 | 86-252 | None |
| A0A6J4JCE6 | 245-393 | None |
| A0A2V6PT38 | 11-171 | None |
| A0A3M9MCK7 | 29-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.