DPCstruct | MC12226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 120 ± 17 aa |
| Standard deviation of domain lengths | 16.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7DD01 | 3-96 | LDGDAVASAVLTLVREQGLWRGTASELITYLRMLYPALTESAEAFPRQAAGFGAELRRVTPLLRAHGVEVTHLRKGKERKRLVCIAK… |
| A0A2A5E237 | 1-103 | MDNSPAALAIYELMQEYPVWEKTAQDLLRELDKHNIDAWPKTPESLTHLLRRMTPAFEEFGLQVEFLPRERNRRLIRITNTEYSEGN… |
| A0A5C5XEQ7 | 119-251 | None |
| A0A2T5EXD5 | 133-272 | None |
| A0A354GKN5 | 47-181 | None |
| A0A7X7F7N1 | 78-194 | None |
| A0A372V1L5 | 54-188 | None |
| A0A062VDA3 | 190-301 | None |
| A0A836BL93 | 461-579 | None |
| A0A645HP36 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.