DPCstruct | MC12225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F4KBU1 | 38-163 | ELQFSDLQGFDRDLAGSLSSPLPKVDVAFYDRIAPSALPERLQHWMASVEAGGGTVTVVPPPSSVTPKSPMLLISAISTLWSASKMA… |
| A0A2A5DBJ3 | 1-121 | MFGDDLIDEFTISKSLRAGQSQVEMFTPEGVNINEIPEGLDMWLSRIKDSGGTVKAQAKPEPGEGTRGFLGIFIDVALYLIGLAKDE… |
| A0A7I0IIY3 | 68-200 | None |
| A0A117V3G2 | 5-99 | None |
| A0A1Y1Q4M5 | 87-234 | None |
| A0A3C1S8X8 | 97-224 | None |
| A0A0M1JCS1 | 53-168 | None |
| M3HVV0 | 48-177 | None |
| A0A7X2LT08 | 49-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.