DPCstruct | MC12220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 166 ± 26 aa |
| Standard deviation of domain lengths | 25.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1IVV6 | 23-169 | ASTSELLKCLGIFLRDRCCKLQDFQAGDAVMWLRAVDRSLLLQGWQDIAFINPANVVFVYMLVREIVDGDETKELDLQAKVLTCLYL… |
| A0A4U5VUW4 | 79-256 | DVTVAAKKNSLTGSGIQPSTAAGTPKRVIVQASTSELMRSLGEFLCRRCYRLKRLSPTDPVLWLRNVDRSLLLQGWQDQGFITPANV… |
| A0A1I8IJ35 | 27-222 | None |
| A0A834Y5Q9 | 295-469 | None |
| A0A6A4KAR9 | 9-127 | None |
| T1FXL5 | 34-184 | None |
| M7CK36 | 11-184 | None |
| A0A7R8CGE1 | 23-179 | None |
| T1K2G8 | 365-543 | None |
| A0A0N4V1U0 | 25-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.