DPCstruct | MC1222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9DYS3 | 1-62 | MSMALVMSEMPDLVRRVKAEHVPDAAGRCGGCRDTAGRTASWPCQTYRIAQEAEWVGRGNLP |
| A0A7J9W647 | 1-62 | MAMAQVMSGMPDVWRRVLAEHEPDERGRCRACRNEQGVSAEWPCLTRDIAEQAKRIHDGELP |
| A0A1Q4E077 | 12-81 | None |
| A0A263DWL4 | 8-66 | None |
| A0A852WDP3 | 1-80 | None |
| A0A1Q9SM18 | 11-73 | None |
| A0A841NPK8 | 20-83 | None |
| A0A1M6W163 | 11-70 | None |
| A0A1M6NK31 | 1-79 | None |
| A0A561SV25 | 11-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.