DPCstruct | MC12219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 161 ± 26 aa |
| Standard deviation of domain lengths | 26.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498LLS9 | 2-123 | KALCRLTAVARGFLTRRLLQTDKITHLRKTIQDSRDFIRSFQTDSQLKRVSVSHQDLSLYQRVTAQLRSALHDVHQIFIVWPVRDRL… |
| A0A4U5VU97 | 42-182 | GSKQTSSKAKSGTYAKIDKRVLTAEQQRAFCRIGAIIRGFLTRRLLKTEKVKHLRQTIVDTQEFIRSFKTEGSQKKGTYSAQDRSLQ… |
| W5M4L6 | 524-663 | None |
| A0A668RUJ2 | 1-144 | None |
| A0A5N4A5Z0 | 249-405 | None |
| A0A5K4FD02 | 241-371 | None |
| A0A183M4G3 | 6-226 | None |
| A0A182XX62 | 2-196 | None |
| A0A6P4K9B0 | 609-749 | None |
| T1KFK6 | 216-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.