DPCstruct | MC12216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 17 aa |
| Standard deviation of domain lengths | 16.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 12.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855W463 | 4-95 | QPDYQLGLMAGYQENRYSFTAKGGSYIYSREGGFRDETGSFPDGERAIGYKQHFKMPNIGLTGNYRYDSYEFGGSFKYSGWVKASDK… |
| A0A537PBX4 | 1-110 | MRKLAIALTFGSALTLSMPAMAADIVEEAYDWSGFYGGVFAGVGYTSSDWDGTDESATLPPVSIDESLNDTAFLLGALAGINFQHDS… |
| A0A5S3RQC6 | 2-75 | None |
| F2NR54 | 34-120 | None |
| A0A7D5N957 | 11-81 | None |
| A0A0Q4JXV4 | 1-71 | None |
| A0A521E1W2 | 1-109 | None |
| A0A2V9YLZ0 | 6-84 | None |
| A0A7Z0JMW1 | 4-90 | None |
| A0A850I219 | 14-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.