DPCstruct | MC12215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537PBW5 | 1-98 | MSARFPVLIATALCLASFSIPMAKAETGLRTYFNPAVYGKPVSICMSDRQSCGKPSADAWCRDHGYTEALVFERLKTADRSQVFRQI… |
| A0A0W0YVA4 | 121-196 | EKRFVVPRYNDYRVDWCYNKNQGCGRRAANSFCSRMGFMQAKRFERENHISATKAIGSQELCFGNQCNAFKSIVCY |
| A0A545TQX6 | 519-624 | None |
| W7T4L6 | 35-147 | None |
| F2LUA4 | 362-459 | None |
| A0A1H0W0T9 | 287-378 | None |
| H1FU55 | 57-160 | None |
| A0A656HD42 | 34-147 | None |
| A0A1G7ZXC0 | 7-108 | None |
| A0A8A9F1Y6 | 125-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.