DPCstruct | MC12214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 228 ± 47 aa |
| Standard deviation of domain lengths | 46.62 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537P102 | 11-229 | EDAFEFFEPFVRNGWASFHTAGMLGQGERVWVLARLAEQIVIADDDAVERFLLLSNQHDGSGAVTIRFTPVRVVCQNTLNLAMEGRK… |
| A0A7C1R4T1 | 13-308 | SSDQFMSANTRSIPYQELKHGSIIPSFKDNESTISHTEFIDAFGEVCDSFFLGERILSQAIRVSHPIRGRIPQAVGKPAKELKENEK… |
| A0A1F2RUE4 | 5-193 | None |
| A0A538Q7W1 | 105-351 | None |
| A0A2R7YBD0 | 1-153 | None |
| A0A7Y8VP67 | 10-190 | None |
| A0A417WSM2 | 33-260 | None |
| H6SJP6 | 230-458 | None |
| A0A2E4HLC0 | 19-252 | None |
| A0A7C5J6C5 | 18-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.