DPCstruct | MC12212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 240 ± 50 aa |
| Standard deviation of domain lengths | 50.05 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.30 |
| Pfam Score | 80.11 |
| Assigned Pfam label(s) | CL0369- CL0103- PF02884 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A894KF59 | 378-653 | ARKSYHFIDGMIVCLGSDIENTNTEFPTETTIFQLAVTDKAGHDYWKNYQGDKKVWVDHLGTGYYVPTPIRFEKNFPQYSRMQNTGK… |
| A0A7K2KTH8 | 6-181 | EERTGSWRDINTGGSPDPVTRRYLTLFTDHGVDPAGGAYAYVLLPGASAHATARAAHDRGRLRILANSGARQGIHVPRLGLTAVNFW… |
| A0A3R8PLA1 | 21-296 | None |
| F3PP21 | 658-907 | None |
| A0A7D7WBX3 | 1-130 | None |
| A0A2E9IMI8 | 471-713 | None |
| A0A7J9Y5W3 | 1-134 | None |
| A0A6C2U2P8 | 1-151 | None |
| A0A5S4EZV4 | 372-592 | None |
| A0A1G9YTF2 | 441-672 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.