DPCstruct | MC12210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 111 ± 24 aa |
| Standard deviation of domain lengths | 23.63 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5N3H2 | 50-134 | SFCTTKGLSVNELYSVLDSVNRYFPGAVSKEALLYDPEDETTHAVISVHLDTNVIEARRKLRAFDNEWWLHQPNNIRNTLTVKLE |
| A0A7V9SC26 | 12-118 | LMRELAREYQIADEDEVLAFLERHPDAAPLLFDIRSNIRRYFGDDAVRLDMSYDLEWPEDGPEMVANIQTPLRSADAIDSWRQLGRD… |
| A0A2U2SGS6 | 38-157 | None |
| A0A7X7VGT6 | 3-95 | None |
| A0A6I1ZG66 | 69-189 | None |
| A0A3S1BEL1 | 5-110 | None |
| A0A661SA38 | 116-208 | None |
| A0A354GM39 | 15-106 | None |
| A0A354GRA6 | 1-110 | None |
| A0A7C2YB64 | 26-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.