DPCstruct | MC12209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M6JXB1 | 8-127 | GPVPEQAWHADALARERGRVQIFNATRPDGLDGWTMDAQQYELMRAHILDMIDEHADADGTIALRDVIDAAQRRYATHPLFPGGRTR… |
| A0A7Y5H4R7 | 2-99 | PKKSQVQSTKRVRVKGLGWKRSVAIDSDKYKIVSKAILSVLTTSPIRFTEIVRLVEKKIPDFEGSLSWYTISVARELEAQGKIIRHP… |
| M9RLY7 | 1-107 | None |
| A0A5C4X7Z1 | 55-154 | None |
| A0A0N8K5U3 | 2-119 | None |
| A0A136L015 | 2-96 | None |
| A0A6P2B4W6 | 259-348 | None |
| A0A385SXJ7 | 2-101 | None |
| A0A539DBJ0 | 9-117 | None |
| A0A385SQJ7 | 2-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.